PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Do000733.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Panicodae; Paniceae; Dichantheliinae; Dichanthelium
Family NF-YC
Protein Properties Length: 130aa    MW: 14542.4 Da    PI: 4.0848
Description NF-YC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Do000733.1genomeDichanView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NF-YC113.51.1e-3517230101
       NF-YC  30 lkadedvkmisaeaPvllskacelfileltlrswlhaeenkrrtlkksdiaaavtrtdifdflvdivprdel 101
                 +kadedvkmi+aeaPv+++kace+fileltlrswlh+e ++rrtl++sd+aaa+t  ++fdfl+d+ p +e+
  Do000733.1   1 MKADEDVKMIAAEAPVVFAKACEMFILELTLRSWLHTEGTNRRTLQRSDVAAAITANEMFDFLMDVAPVEER 72 
                 9*******************************************************************9976 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF008081.3E-12154IPR003958Transcription factor CBF/NF-Y/archaeal histone domain
SuperFamilySSF471131.56E-21168IPR009072Histone-fold
Gene3DG3DSA:1.10.20.102.5E-26167IPR009072Histone-fold
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0046982Molecular Functionprotein heterodimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 130 aa     Download sequence    Send to blast
MKADEDVKMI AAEAPVVFAK ACEMFILELT LRSWLHTEGT NRRTLQRSDV AAAITANEMF  60
DFLMDVAPVE ERRGDGVLPP PPTTPLSYGP GPAMSASFPT YANQQPMQFM WPPPEFQQQQ  120
QQNPDEGQDE
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
4awl_C6e-291682693NUCLEAR TRANSCRIPTION FACTOR Y SUBUNIT GAMMA
4csr_B6e-291682693NUCLEAR TRANSCRIPTION FACTOR Y SUBUNIT GAMMA
Search in ModeBase
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
14147RRTLQRS
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_002437420.15e-37hypothetical protein SORBIDRAFT_10g026680
SwissprotQ8LCG71e-38NFYC2_ARATH; Nuclear transcription factor Y subunit C-2
TrEMBLK3YND45e-52K3YND4_SETIT; Uncharacterized protein
STRINGSi015775m1e-51(Setaria italica)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP157031216
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G56170.24e-35nuclear factor Y, subunit C2